GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS


Price and Availability of HY-P1231
Size Price Stock
5mg $235 In-stock
10mg $380 In-stock
50 mg Get quote
100 mg Get quote
We match the lowest price on market.

We offer a substantial discount on larger orders, please inquire via [email protected]

or Fax: (86)21-58955996

Inquiry for price and availability only. Please place your order via our email or fax.

Cat. No. : HY-P1231
M.Wt: 3850.31
Formula: N/A
Purity: >98 %
Solubility: 10 mM in DMSO
Introduction of GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS :

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. In Vitro: Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia[1].

Your information is safe with us.