| Size | Price | Stock |
|---|---|---|
| 5mg | $220 | In-stock |
| 10mg | $350 | In-stock |
| 50 mg | Get quote | |
| 100 mg | Get quote | |
| We match the lowest price on market. | ||
We offer a substantial discount on larger orders, please inquire via [email protected]
or Fax: (86)21-58955996
Inquiry for price and availability only. Please place your order via our email or fax.
| Cat. No. : | HY-P1229 |
| M.Wt: | 3692.15 |
| Formula: | N/A |
| Purity: | >98 % |
| Solubility: | 10 mM in DMSO |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. In Vitro: Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia[1].
Lorem ipsum dolor sit amet, consectetur adipisicing elit. Autem earum hic iste maiores, nam neque rem suscipit. Adipisci consequatur error exercitationem fugit ipsam optio qui, quibusdam repellendus sed vero! Debitis.
Inquiry Information
Your information is safe with us.